Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.294: EndoU-like [142876] (1 superfamily) comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075) |
Superfamily d.294.1: EndoU-like [142877] (3 families) similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily) |
Family d.294.1.0: automated matches [356574] (1 protein) not a true family |
Protein automated matches [356575] (3 species) not a true protein |
Species Human coronavirus 229E [TaxId:11137] [419930] (2 PDB entries) |
Domain d4s1td2: 4s1t D:192-346 [414312] Other proteins in same PDB: d4s1ta1, d4s1ta3, d4s1tb1, d4s1tb3, d4s1tc1, d4s1tc3, d4s1td1, d4s1td3, d4s1te1, d4s1te3, d4s1tf1, d4s1tf3 automated match to d5yvda2 complexed with po4; mutant |
PDB Entry: 4s1t (more details), 2.5 Å
SCOPe Domain Sequences for d4s1td2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4s1td2 d.294.1.0 (D:192-346) automated matches {Human coronavirus 229E [TaxId: 11137]} dgfytqgrnlqdflprstmeedflnmdigvfiqkygledfnfehvvygdvskttlgglhl lisqvrlskmgilkaeefvaasditlkcctvtylndpssktvctymdlllddfvsvlksl dltvvskvheviidnkpwrwmlwckdnavatfypq
Timeline for d4s1td2: