Lineage for d4s1td2 (4s1t D:192-346)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009981Fold d.294: EndoU-like [142876] (1 superfamily)
    comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)
  4. 3009982Superfamily d.294.1: EndoU-like [142877] (3 families) (S)
    similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)
  5. 3010074Family d.294.1.0: automated matches [356574] (1 protein)
    not a true family
  6. 3010075Protein automated matches [356575] (3 species)
    not a true protein
  7. 3010076Species Human coronavirus 229E [TaxId:11137] [419930] (2 PDB entries)
  8. 3010080Domain d4s1td2: 4s1t D:192-346 [414312]
    Other proteins in same PDB: d4s1ta1, d4s1ta3, d4s1tb1, d4s1tb3, d4s1tc1, d4s1tc3, d4s1td1, d4s1td3, d4s1te1, d4s1te3, d4s1tf1, d4s1tf3
    automated match to d5yvda2
    complexed with po4; mutant

Details for d4s1td2

PDB Entry: 4s1t (more details), 2.5 Å

PDB Description: crystal structure of the mutant i26a/n52a of the endoribonuclease from human coronavirus 229e
PDB Compounds: (D:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d4s1td2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s1td2 d.294.1.0 (D:192-346) automated matches {Human coronavirus 229E [TaxId: 11137]}
dgfytqgrnlqdflprstmeedflnmdigvfiqkygledfnfehvvygdvskttlgglhl
lisqvrlskmgilkaeefvaasditlkcctvtylndpssktvctymdlllddfvsvlksl
dltvvskvheviidnkpwrwmlwckdnavatfypq

SCOPe Domain Coordinates for d4s1td2:

Click to download the PDB-style file with coordinates for d4s1td2.
(The format of our PDB-style files is described here.)

Timeline for d4s1td2:

  • d4s1td2 is new in SCOPe 2.08-stable