SCOPe 2.08: Domain d4s1tb2: 4s1t B:192-346

Lineage for d4s1tb2 (4s1t B:192-346)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.294: EndoU-like [142876] (1 superfamily)
   comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)

4. Superfamily d.294.1: EndoU-like [142877] (3 families)
   similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)

5. Family d.294.1.0: automated matches [356574] (1 protein)
   not a true family

6. Protein automated matches [356575] (3 species)
   not a true protein

7. Species Human coronavirus 229E [TaxId:11137] [419930] (2 PDB entries)

8. Domain d4s1tb2: 4s1t B:192-346 [414306]
   Other proteins in same PDB: d4s1ta1, d4s1ta3, d4s1tb1, d4s1tb3, d4s1tc1, d4s1tc3, d4s1td1, d4s1td3, d4s1te1, d4s1te3, d4s1tf1, d4s1tf3
   automated match to d5yvda2
   complexed with po4; mutant

Details for d4s1tb2

PDB Entry: 4s1t, 2.5 Å

PDB Description: crystal structure of the mutant i26a/n52a of the endoribonuclease from human coronavirus 229e

PDB Compounds: (B:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d4s1tb2:

Sequence; same for both SEQRES and ATOM records:

>d4s1tb2 d.294.1.0 (B:192-346) automated matches {Human coronavirus 229E [TaxId: 11137]}
dgfytqgrnlqdflprstmeedflnmdigvfiqkygledfnfehvvygdvskttlgglhl
lisqvrlskmgilkaeefvaasditlkcctvtylndpssktvctymdlllddfvsvlksl
dltvvskvheviidnkpwrwmlwckdnavatfypq

Timeline for d4s1tb2:

• d4s1tb2 is new in SCOPe 2.08-stable