SCOPe 2.08: Domain d4rzxb_: 4rzx B:

Lineage for d4rzxb_ (4rzx B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [419822] (5 PDB entries)

8. Domain d4rzxb_: 4rzx B: [414301]
   automated match to d5zb4b_
   complexed with ni, po4

Details for d4rzxb_

PDB Entry: 4rzx, 2.3 Å

PDB Description: crystal structure (type-3) of dtmp kinase (st1543) from sulfolobus tokodaii strain7

PDB Compounds: (B:) Probable thymidylate kinase

SCOPe Domain Sequences for d4rzxb_:

Sequence, based on SEQRES records:

>d4rzxb_ c.37.1.0 (B:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
kgvliafegidgsgkssqatllkdwielkrdvyltewnssdwihdiikeakkkdlltplt
fslihatdfsdryeryilpmlksgfivisdryiytayardsvrgvdidwvkklysfaikp
ditfyirvspdialerikkskrkikpqeagadifpglspeegflkyqglitevydklvkd
enfividgtktpkeiqiqirkfvgel

Sequence, based on observed residues (ATOM records):

>d4rzxb_ c.37.1.0 (B:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
kgvliafegidgsgkssqatllkdwielkrdvyltedwihdiikeaklltpltfslihat
dfsdryeryilpmlksgfivisdryiytayardsvrgvdidwvkklysfaikpditfyir
vspdialerikkskrkikpqeagadifpglspeegflkyqglitevydklvkdenfivid
gtktpkeiqiqirkfvgel

Timeline for d4rzxb_:

• d4rzxb_ is new in SCOPe 2.08-stable