SCOPe 2.02: Domain d1axce1: 1axc E:1-126

Lineage for d1axce1 (1axc E:1-126)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55991] (7 PDB entries)
   Uniprot P12004

8. Domain d1axce1: 1axc E:1-126 [41396]
   protein/DNA complex

Details for d1axce1

PDB Entry: 1axc, 2.6 Å

PDB Description: human pcna

PDB Compounds: (E:) pcna

SCOPe Domain Sequences for d1axce1:

Sequence; same for both SEQRES and ATOM records:

>d1axce1 d.131.1.2 (E:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

Timeline for d1axce1:

• d1axce1 first appeared (with stable ids) in SCOP 1.55
  
• d1axce1 appears in SCOPe 2.01
  
• d1axce1 appears in SCOPe 2.03
  
• d1axce1 appears in the current release, SCOPe 2.08