Lineage for d1axcc1 (1axc C:1-126)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196753Fold d.131: DNA clamp [55978] (1 superfamily)
  4. 196754Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 196773Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins)
  6. 196795Protein Prolifirating cell nuclear antigen (PCNA) [55989] (3 species)
  7. 196804Species Human (Homo sapiens) [TaxId:9606] [55991] (1 PDB entry)
  8. 196807Domain d1axcc1: 1axc C:1-126 [41394]

Details for d1axcc1

PDB Entry: 1axc (more details), 2.6 Å

PDB Description: human pcna

SCOP Domain Sequences for d1axcc1:

Sequence, based on SEQRES records: (download)

>d1axcc1 d.131.1.2 (C:1-126) Prolifirating cell nuclear antigen (PCNA) {Human (Homo sapiens)}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

Sequence, based on observed residues (ATOM records): (download)

>d1axcc1 d.131.1.2 (C:1-126) Prolifirating cell nuclear antigen (PCNA) {Human (Homo sapiens)}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapekvsdyemklmdld
veql

SCOP Domain Coordinates for d1axcc1:

Click to download the PDB-style file with coordinates for d1axcc1.
(The format of our PDB-style files is described here.)

Timeline for d1axcc1: