Lineage for d1dmle1 (1dml E:28-169)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418559Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 418560Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 418591Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins)
    duplication: consists of two domains of this fold
  6. 418644Protein UL42 [55987] (1 species)
  7. 418645Species Human herpes virus type 1 [55988] (1 PDB entry)
  8. 418650Domain d1dmle1: 1dml E:28-169 [41384]

Details for d1dmle1

PDB Entry: 1dml (more details), 2.7 Å

PDB Description: crystal structure of herpes simplex ul42 bound to the c-terminus of hsv pol

SCOP Domain Sequences for d1dmle1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dmle1 d.131.1.2 (E:28-169) UL42 {Human herpes virus type 1}
gapcqvvlqgaelngilqafaplrtslldsllvmgdrgilihntifgeqvflplehsqfs
ryrwrgptaaflslvdqkrsllsvfranqypdlrrvelaitgqapfrtlvqriwtttsdg
eavelasetlmkreltsfvvlv

SCOP Domain Coordinates for d1dmle1:

Click to download the PDB-style file with coordinates for d1dmle1.
(The format of our PDB-style files is described here.)

Timeline for d1dmle1: