Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (2 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins) duplication: consists of two domains of this fold |
Protein UL42 [55987] (1 species) |
Species Human herpes virus type 1 [55988] (1 PDB entry) |
Domain d1dmle1: 1dml E:28-169 [41384] |
PDB Entry: 1dml (more details), 2.7 Å
SCOP Domain Sequences for d1dmle1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dmle1 d.131.1.2 (E:28-169) UL42 {Human herpes virus type 1} gapcqvvlqgaelngilqafaplrtslldsllvmgdrgilihntifgeqvflplehsqfs ryrwrgptaaflslvdqkrsllsvfranqypdlrrvelaitgqapfrtlvqriwtttsdg eavelasetlmkreltsfvvlv
Timeline for d1dmle1: