Lineage for d1dmle1 (1dml E:28-169)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. Protein UL42 [55987] (1 species)
  7. Species Human herpesvirus type 1 [TaxId:10298] [55988] (1 PDB entry)
  8. Domain d1dmle1: 1dml E:28-169 [41384]
    protein/DNA complex

Details for d1dmle1

PDB Entry: 1dml (more details), 2.7 Å

PDB Description: crystal structure of herpes simplex ul42 bound to the c-terminus of hsv pol
PDB Compounds: (E:) DNA polymerase processivity factor

SCOPe Domain Sequences for d1dmle1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dmle1 d.131.1.2 (E:28-169) UL42 {Human herpesvirus type 1 [TaxId: 10298]}
gapcqvvlqgaelngilqafaplrtslldsllvmgdrgilihntifgeqvflplehsqfs
ryrwrgptaaflslvdqkrsllsvfranqypdlrrvelaitgqapfrtlvqriwtttsdg
eavelasetlmkreltsfvvlv

SCOPe Domain Coordinates for d1dmle1 are not available.

Timeline for d1dmle1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dmle2
View in 3D
Domains from other chains:
(mouse over for more information)
d1dmla1, d1dmla2, d1dmlc1, d1dmlc2, d1dmlg1, d1dmlg2