Lineage for d1b77b1 (1b77 B:1-110)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583540Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2583541Protein gp45 sliding clamp [55984] (2 species)
  7. 2583542Species Bacteriophage RB69 [TaxId:12353] [55985] (2 PDB entries)
  8. 2583545Domain d1b77b1: 1b77 B:1-110 [41364]
    protein/DNA complex

Details for d1b77b1

PDB Entry: 1b77 (more details), 2.1 Å

PDB Description: building a replisome structure from interacting pieces: a sliding clamp complexed with an interaction peptide from dna polymerase
PDB Compounds: (B:) protein (sliding clamp)

SCOPe Domain Sequences for d1b77b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b77b1 d.131.1.2 (B:1-110) gp45 sliding clamp {Bacteriophage RB69 [TaxId: 12353]}
mklskdtiailknfasinsgillsqgkfimtravngttyaeanisdeidfdvalydlnsf
lsilslvsddaeismhtdgnikiadtrstvywpaadkstivfpnkpiqfp

SCOPe Domain Coordinates for d1b77b1:

Click to download the PDB-style file with coordinates for d1b77b1.
(The format of our PDB-style files is described here.)

Timeline for d1b77b1: