SCOP 1.57: Domain d1b77a1: 1b77 A:1-110

Lineage for d1b77a1 (1b77 A:1-110)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins)

6. Protein gp45 sliding clamp [55984] (2 species)

7. Species Bacteriophage RB69 [TaxId:12353] [55985] (2 PDB entries)

8. Domain d1b77a1: 1b77 A:1-110 [41362]

Details for d1b77a1

PDB Entry: 1b77, 2.1 Å

PDB Description: building a replisome structure from interacting pieces: a sliding clamp complexed with an interaction peptide from dna polymerase

SCOP Domain Sequences for d1b77a1:

Sequence; same for both SEQRES and ATOM records:

>d1b77a1 d.131.1.2 (A:1-110) gp45 sliding clamp {Bacteriophage RB69}
mklskdtiailknfasinsgillsqgkfimtravngttyaeanisdeidfdvalydlnsf
lsilslvsddaeismhtdgnikiadtrstvywpaadkstivfpnkpiqfp

Timeline for d1b77a1:

• d1b77a1 first appeared (with stable ids) in SCOP 1.55
  
• d1b77a1 appears in SCOP 1.59
  
• d1b77a1 appears in the current release, SCOPe 2.08