SCOPe 2.08: Domain d3wg9a2: 3wg9 A:82-217

Lineage for d3wg9a2 (3wg9 A:82-217)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Thermoanaerobacter ethanolicus [TaxId:509192] [419886] (3 PDB entries)

8. Domain d3wg9a2: 3wg9 A:82-217 [413527]
   Other proteins in same PDB: d3wg9a1, d3wg9b1, d3wg9c1, d3wg9d1
   automated match to d5zz5a2
   complexed with so4

Details for d3wg9a2

PDB Entry: 3wg9, 1.97 Å

PDB Description: crystal structure of rsp, a rex-family repressor

PDB Compounds: (A:) Redox-sensing transcriptional repressor rex

SCOPe Domain Sequences for d3wg9a2:

Sequence; same for both SEQRES and ATOM records:

>d3wg9a2 c.2.1.0 (A:82-217) automated matches {Thermoanaerobacter ethanolicus [TaxId: 509192]}
dktyntiiigagnlgqaianytsfeksgfnlkgifdinprlfglkirdvevmdvetvedf
iarnkidigilcipkdnaqytadrlvragikaiwnflpidlkvpddvilenvhlsdslft
vsyrlneeelfkklkg

Timeline for d3wg9a2:

• d3wg9a2 is new in SCOPe 2.08-stable