Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Thermoanaerobacter ethanolicus [TaxId:509192] [419886] (3 PDB entries) |
Domain d3wg9a2: 3wg9 A:82-217 [413527] Other proteins in same PDB: d3wg9a1, d3wg9b1, d3wg9c1, d3wg9d1 automated match to d5zz5a2 complexed with so4 |
PDB Entry: 3wg9 (more details), 1.97 Å
SCOPe Domain Sequences for d3wg9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wg9a2 c.2.1.0 (A:82-217) automated matches {Thermoanaerobacter ethanolicus [TaxId: 509192]} dktyntiiigagnlgqaianytsfeksgfnlkgifdinprlfglkirdvevmdvetvedf iarnkidigilcipkdnaqytadrlvragikaiwnflpidlkvpddvilenvhlsdslft vsyrlneeelfkklkg
Timeline for d3wg9a2: