SCOPe 2.08: Domain d3r1oa_: 3r1o A:

Lineage for d3r1oa_ (3r1o A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.0: automated matches [191595] (1 protein)
   not a true family

6. Protein automated matches [191085] (10 species)
   not a true protein

7. Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [193461] (7 PDB entries)

8. Domain d3r1oa_: 3r1o A: [413375]
   automated match to d6hhea_
   complexed with plm

Details for d3r1oa_

PDB Entry: 3r1o, 2.1 Å

PDB Description: odorant binding protein 7 from anopheles gambiae with four disulfide bridges

PDB Compounds: (A:) Odorant binding protein, antennal

SCOPe Domain Sequences for d3r1oa_:

Sequence, based on SEQRES records:

>d3r1oa_ a.39.2.0 (A:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
rykkpakmlheiciaesgaseeqlrtcldgtvptapaakcyihclfdkidvvdeatgril
ldrllyiipddvkaavdhltrecshivtpdkcetayetvkcyfnahdevikfchllvle

Sequence, based on observed residues (ATOM records):

>d3r1oa_ a.39.2.0 (A:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
rykkpakmlheiciaesgaseeqlrtcldgtvptapaakcyihclfdkidvvdeatgril
ldrllyiihltrecshivtpdkcetayetvkcyfnahdevikfchllvle

Timeline for d3r1oa_:

• d3r1oa_ is new in SCOPe 2.08-stable