SCOP 1.69: Domain d1b6fa_: 1b6f A:

Lineage for d1b6fa_ (1b6f A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.129: TBP-like [55944] (8 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (5 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (3 proteins)

6. Protein Major tree pollen allergen [55963] (4 species)

7. Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (5 PDB entries)

8. Domain d1b6fa_: 1b6f A: [41316]

Details for d1b6fa_

PDB Entry: 1b6f

PDB Description: birch pollen allergen bet v 1

SCOP Domain Sequences for d1b6fa_:

Sequence; same for both SEQRES and ATOM records:

>d1b6fa_ d.129.3.1 (A:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1}
gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskelgetllravesyllahsdayn

Timeline for d1b6fa_:

• d1b6fa_ first appeared (with stable ids) in SCOP 1.55
  
• d1b6fa_ appears in SCOP 1.67
  
• d1b6fa_ appears in SCOP 1.71
  
• d1b6fa_ appears in the current release, SCOPe 2.08