Lineage for d1b6fa_ (1b6f A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418216Fold d.129: TBP-like [55944] (7 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 418378Superfamily d.129.3: Bet v1-like [55961] (4 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 418379Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (3 proteins)
  6. 418384Protein Major tree pollen allergen [55963] (4 species)
  7. 418395Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (5 PDB entries)
  8. 418399Domain d1b6fa_: 1b6f A: [41316]

Details for d1b6fa_

PDB Entry: 1b6f (more details)

PDB Description: birch pollen allergen bet v 1

SCOP Domain Sequences for d1b6fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6fa_ d.129.3.1 (A:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1}
gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskelgetllravesyllahsdayn

SCOP Domain Coordinates for d1b6fa_:

Click to download the PDB-style file with coordinates for d1b6fa_.
(The format of our PDB-style files is described here.)

Timeline for d1b6fa_: