Lineage for d1b6fa_ (1b6f A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.129: TBP-like [55944] (4 superfamilies) 
Superfamily d.129.3: Bet v1-like [55961] (4 families) 
Family d.129.3.1: Major tree pollen allergen [55962] (1 protein) Protein Major tree pollen allergen [55963] (3 species) Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (4 PDB entries) 
Domain d1b6fa_: 1b6f A: [41316]
Details for d1b6fa_
PDB Entry: 1b6f (more details)
PDB Description: birch pollen allergen bet v 1
SCOP Domain Sequences for d1b6fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b6fa_ d.129.3.1 (A:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1}
gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskelgetllravesyllahsdayn
SCOP Domain Coordinates for d1b6fa_:
Click to download the PDB-style file with coordinates for d1b6fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b6fa_:
- d1b6fa_ first appeared (with stable ids) in SCOP 1.55
- d1b6fa_ appears in SCOP 1.57
- d1b6fa_ appears in SCOP 1.61
- d1b6fa_ appears in the current release, SCOPe 2.08
View in 3D