| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) ![]() |
| Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats |
| Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
| Species Pyrococcus woesei [TaxId:2262] [55951] (3 PDB entries) |
| Domain d1d3ua1: 1d3u A:1-92 [41290] Other proteins in same PDB: d1d3ub1, d1d3ub2 protein/DNA complex |
PDB Entry: 1d3u (more details), 2.4 Å
SCOPe Domain Sequences for d1d3ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d3ua1 d.129.1.1 (A:1-92) TATA-box binding protein (TBP), C-terminal domain {Pyrococcus woesei [TaxId: 2262]}
mvdmskvklrienivasvdlfaqldlekvldlcpnskynpeefpgiichlddpkvallif
ssgklvvtgaksvqdieravaklaqklksigv
Timeline for d1d3ua1: