Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.129: TBP-like [55944] (9 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) |
Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats |
Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (6 PDB entries) |
Domain d1tbpb2: 1tbp B:156-240 [41285] |
PDB Entry: 1tbp (more details), 2.6 Å
SCOP Domain Sequences for d1tbpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tbpb2 d.129.1.1 (B:156-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} kiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifvsgkivlt gakqreeiyqafeaiypvlsefrkm
Timeline for d1tbpb2: