![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.129: TBP-like [55944] (3 superfamilies) |
![]() | Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) ![]() |
![]() | Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) |
![]() | Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (4 PDB entries) |
![]() | Domain d1tbpb2: 1tbp B:156-240 [41285] |
PDB Entry: 1tbp (more details), 2.6 Å
SCOP Domain Sequences for d1tbpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tbpb2 d.129.1.1 (B:156-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} kiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifvsgkivlt gakqreeiyqafeaiypvlsefrkm
Timeline for d1tbpb2: