Lineage for d1voka2 (1vok A:116-198)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040331Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1040332Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 1040333Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
  6. 1040334Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 1040393Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [55949] (13 PDB entries)
  8. 1040411Domain d1voka2: 1vok A:116-198 [41243]
    complexed with so4

Details for d1voka2

PDB Entry: 1vok (more details), 2.1 Å

PDB Description: arabidopsis thaliana tbp (dimer)
PDB Compounds: (A:) tata-box-binding protein

SCOPe Domain Sequences for d1voka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1voka2 d.129.1.1 (A:116-198) TATA-box binding protein (TBP), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qnivgscdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitga
kmrdetykafeniypvlsefrki

SCOPe Domain Coordinates for d1voka2:

Click to download the PDB-style file with coordinates for d1voka2.
(The format of our PDB-style files is described here.)

Timeline for d1voka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1voka1