| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) ![]() |
| Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats |
| Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [55949] (13 PDB entries) |
| Domain d1qn5b2: 1qn5 B:116-197 [41237] |
PDB Entry: 1qn5 (more details), 1.93 Å
SCOPe Domain Sequences for d1qn5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qn5b2 d.129.1.1 (B:116-197) TATA-box binding protein (TBP), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qnivgscdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitga
kmrdetykafeniypvlsefrk
Timeline for d1qn5b2: