SCOP 1.61: Domain d1qn5b2: 1qn5 B:116-197

Lineage for d1qn5b2 (1qn5 B:116-197)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.129: TBP-like [55944] (4 superfamilies)

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)

7. Species Arabidopsis thaliana [TaxId:3702] [55949] (13 PDB entries)

8. Domain d1qn5b2: 1qn5 B:116-197 [41237]

Details for d1qn5b2

PDB Entry: 1qn5, 1.93 Å

PDB Description: crystal structure of the g(-26) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.

SCOP Domain Sequences for d1qn5b2:

Sequence; same for both SEQRES and ATOM records:

>d1qn5b2 d.129.1.1 (B:116-197) TATA-box binding protein (TBP), C-terminal domain {Arabidopsis thaliana}
qnivgscdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitga
kmrdetykafeniypvlsefrk

Timeline for d1qn5b2:

• d1qn5b2 first appeared (with stable ids) in SCOP 1.55
  
• d1qn5b2 appears in SCOP 1.59
  
• d1qn5b2 appears in SCOP 1.63
  
• d1qn5b2 appears in the current release, SCOPe 2.08