SCOPe 2.08: Domain d1c9bn2: 1c9b N:253-337

Lineage for d1c9bn2 (1c9b N:253-337)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats
   automatically mapped to Pfam PF00352

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
   structure of the N-terminal domain is not known yet

7. Species Human (Homo sapiens) [TaxId:9606] [55948] (5 PDB entries)

8. Domain d1c9bn2: 1c9b N:253-337 [41223]
   Other proteins in same PDB: d1c9ba1, d1c9ba2, d1c9be1, d1c9be2, d1c9bi1, d1c9bi2, d1c9bm1, d1c9bm2, d1c9bq1, d1c9bq2
   protein/DNA complex

Details for d1c9bn2

PDB Entry: 1c9b, 2.65 Å

PDB Description: crystal structure of a human tbp core domain-human tfiib core domain complex bound to an extended, modified adenoviral major late promoter (admlp)

PDB Compounds: (N:) tata box binding protein

SCOPe Domain Sequences for d1c9bn2:

Sequence; same for both SEQRES and ATOM records:

>d1c9bn2 d.129.1.1 (N:253-337) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
fkiqnmvgscdvkfpirleglvlthqqfssyepelfpgliyrmikprivllifvsgkvvl
tgakvraeiyeafeniypilkgfrk

Timeline for d1c9bn2:

• d1c9bn2 first appeared (with stable ids) in SCOP 1.55
  
• d1c9bn2 appears in SCOPe 2.07