Lineage for d1c9bn2 (1c9b N:253-337)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975209Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2975210Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
    automatically mapped to Pfam PF00352
  6. 2975211Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 2975237Species Human (Homo sapiens) [TaxId:9606] [55948] (5 PDB entries)
  8. 2975251Domain d1c9bn2: 1c9b N:253-337 [41223]
    Other proteins in same PDB: d1c9ba1, d1c9ba2, d1c9be1, d1c9be2, d1c9bi1, d1c9bi2, d1c9bm1, d1c9bm2, d1c9bq1, d1c9bq2
    protein/DNA complex

Details for d1c9bn2

PDB Entry: 1c9b (more details), 2.65 Å

PDB Description: crystal structure of a human tbp core domain-human tfiib core domain complex bound to an extended, modified adenoviral major late promoter (admlp)
PDB Compounds: (N:) tata box binding protein

SCOPe Domain Sequences for d1c9bn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9bn2 d.129.1.1 (N:253-337) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
fkiqnmvgscdvkfpirleglvlthqqfssyepelfpgliyrmikprivllifvsgkvvl
tgakvraeiyeafeniypilkgfrk

SCOPe Domain Coordinates for d1c9bn2:

Click to download the PDB-style file with coordinates for d1c9bn2.
(The format of our PDB-style files is described here.)

Timeline for d1c9bn2: