PDB entry 1c9b

View 1c9b on RCSB PDB site
Description: crystal structure of a human tbp core domain-human tfiib core domain complex bound to an extended, modified adenoviral major late promoter (admlp)
Class: transcription/DNA
Keywords: protein-DNA complex, cyclin-like fold, helix-turn-helix, tata-box, transcription/DNA complex
Deposited on 1999-08-01, released 2000-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.229
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: general transcription factor iib
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9ba1, d1c9ba2
  • Chain 'B':
    Compound: tata box binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20226 (0-179)
      • conflict (0)
    Domains in SCOPe 2.07: d1c9bb1, d1c9bb2
  • Chain 'C':
    Compound: admlp tata-box DNA containing iib recognition element
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: admlp tata-box DNA containing iib recognition element
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: general transcription factor iib
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9be1, d1c9be2
  • Chain 'F':
    Compound: tata box binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20226 (0-179)
      • conflict (0)
    Domains in SCOPe 2.07: d1c9bf1, d1c9bf2
  • Chain 'G':
    Compound: admlp tata-box DNA containing iib recognition element
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: admlp tata-box DNA containing iib recognition element
    Species: synthetic, synthetic
  • Chain 'I':
    Compound: general transcription factor iib
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9bi1, d1c9bi2
  • Chain 'J':
    Compound: tata box binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20226 (0-179)
      • conflict (0)
    Domains in SCOPe 2.07: d1c9bj1, d1c9bj2
  • Chain 'K':
    Compound: admlp tata-box DNA containing iib recognition element
    Species: synthetic, synthetic
  • Chain 'L':
    Compound: admlp tata-box DNA containing iib recognition element
    Species: synthetic, synthetic
  • Chain 'M':
    Compound: general transcription factor iib
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9bm1, d1c9bm2
  • Chain 'N':
    Compound: tata box binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20226 (0-179)
      • conflict (0)
    Domains in SCOPe 2.07: d1c9bn1, d1c9bn2
  • Chain 'O':
    Compound: admlp tata-box DNA containing iib recognition element
    Species: synthetic, synthetic
  • Chain 'P':
    Compound: admlp tata-box DNA containing iib recognition element
    Species: synthetic, synthetic
  • Chain 'Q':
    Compound: general transcription factor iib
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9bq1, d1c9bq2
  • Chain 'R':
    Compound: tata box binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20226 (0-179)
      • conflict (0)
    Domains in SCOPe 2.07: d1c9br1, d1c9br2
  • Chain 'S':
    Compound: admlp tata-box DNA containing iib recognition element
    Species: synthetic, synthetic
  • Chain 'T':
    Compound: admlp tata-box DNA containing iib recognition element
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bA (A:)
    sdrammnafkeittmadrinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiacr
    qegvprtfkeicavsriskkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqvq
    maathiarkaveldlvpgrspisvaaaaiymasqasaekrtqkeigdiagvadvtirqsy
    rliyprapdlfptdfkfdtpvdklpql
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bB (B:)
    gsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssg
    kmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlth
    qqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bE (E:)
    sdrammnafkeittmadrinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiacr
    qegvprtfkeicavsriskkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqvq
    maathiarkaveldlvpgrspisvaaaaiymasqasaekrtqkeigdiagvadvtirqsy
    rliyprapdlfptdfkfdtpvdklpql
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bF (F:)
    gsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssg
    kmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlth
    qqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrk
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bI (I:)
    sdrammnafkeittmadrinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiacr
    qegvprtfkeicavsriskkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqvq
    maathiarkaveldlvpgrspisvaaaaiymasqasaekrtqkeigdiagvadvtirqsy
    rliyprapdlfptdfkfdtpvdklpql
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bJ (J:)
    gsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssg
    kmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlth
    qqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrk
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bM (M:)
    sdrammnafkeittmadrinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiacr
    qegvprtfkeicavsriskkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqvq
    maathiarkaveldlvpgrspisvaaaaiymasqasaekrtqkeigdiagvadvtirqsy
    rliyprapdlfptdfkfdtpvdklpql
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bN (N:)
    gsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssg
    kmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlth
    qqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrk
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bQ (Q:)
    sdrammnafkeittmadrinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiacr
    qegvprtfkeicavsriskkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqvq
    maathiarkaveldlvpgrspisvaaaaiymasqasaekrtqkeigdiagvadvtirqsy
    rliyprapdlfptdfkfdtpvdklpql
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bR (R:)
    gsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssg
    kmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlth
    qqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrk
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.