Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) |
Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats automatically mapped to Pfam PF00352 |
Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
Species Human (Homo sapiens) [TaxId:9606] [55948] (5 PDB entries) |
Domain d1c9bb2: 1c9b B:253-337 [41217] Other proteins in same PDB: d1c9ba1, d1c9ba2, d1c9be1, d1c9be2, d1c9bi1, d1c9bi2, d1c9bm1, d1c9bm2, d1c9bq1, d1c9bq2 protein/DNA complex |
PDB Entry: 1c9b (more details), 2.65 Å
SCOPe Domain Sequences for d1c9bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c9bb2 d.129.1.1 (B:253-337) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} fkiqnmvgscdvkfpirleglvlthqqfssyepelfpgliyrmikprivllifvsgkvvl tgakvraeiyeafeniypilkgfrk
Timeline for d1c9bb2: