SCOPe 2.05: Domain d1c9bm2: 1c9b M:208-316

Lineage for d1c9bm2 (1c9b M:208-316)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.2: Transcription factor IIB (TFIIB), core domain [47965] (1 protein)

6. Protein Transcription factor IIB (TFIIB), core domain [47966] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47967] (4 PDB entries)

8. Domain d1c9bm2: 1c9b M:208-316 [18379]
   Other proteins in same PDB: d1c9bb1, d1c9bb2, d1c9bf1, d1c9bf2, d1c9bj1, d1c9bj2, d1c9bn1, d1c9bn2, d1c9br1, d1c9br2
   protein/DNA complex

Details for d1c9bm2

PDB Entry: 1c9b, 2.65 Å

PDB Description: crystal structure of a human tbp core domain-human tfiib core domain complex bound to an extended, modified adenoviral major late promoter (admlp)

PDB Compounds: (M:) general transcription factor iib

SCOPe Domain Sequences for d1c9bm2:

Sequence; same for both SEQRES and ATOM records:

>d1c9bm2 a.74.1.2 (M:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]}
littgdfmsrfcsnlclpkqvqmaathiarkaveldlvpgrspisvaaaaiymasqasae
krtqkeigdiagvadvtirqsyrliyprapdlfptdfkfdtpvdklpql

Timeline for d1c9bm2:

• d1c9bm2 first appeared (with stable ids) in SCOP 1.55
  
• d1c9bm2 appears in SCOPe 2.04
  
• d1c9bm2 appears in SCOPe 2.06
  
• d1c9bm2 appears in the current release, SCOPe 2.08