| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) ![]() |
| Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats |
| Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
| Species Human (Homo sapiens) [TaxId:9606] [55948] (5 PDB entries) |
| Domain d1c9bb1: 1c9b B:158-252 [41216] Other proteins in same PDB: d1c9ba1, d1c9ba2, d1c9be1, d1c9be2, d1c9bi1, d1c9bi2, d1c9bm1, d1c9bm2, d1c9bq1, d1c9bq2 protein/DNA complex |
PDB Entry: 1c9b (more details), 2.65 Å
SCOPe Domain Sequences for d1c9bb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c9bb1 d.129.1.1 (B:158-252) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssg
kmvctgakseeqsrlaarkyarvvqklgfpakfld
Timeline for d1c9bb1: