Lineage for d1bg0a2 (1bg0 A:96-357)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974757Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2974758Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2974891Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 2974892Protein Arginine kinase, C-terminal domain [55942] (2 species)
  7. 2974902Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [55943] (14 PDB entries)
    Uniprot P51541
  8. 2974912Domain d1bg0a2: 1bg0 A:96-357 [41211]
    Other proteins in same PDB: d1bg0a1
    complexed with adp, dar, mg, no3

Details for d1bg0a2

PDB Entry: 1bg0 (more details), 1.86 Å

PDB Description: transition state structure of arginine kinase
PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d1bg0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bg0a2 d.128.1.2 (A:96-357) Arginine kinase, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
tdkhppkqwgdintlvgldpagqfiistrvrcgrslqgypfnpcltaeqykemeekvsst
lssmedelkgtyypltgmskatqqqliddhflfkegdrflqtanacrywptgrgifhnda
ktflvwvneedhlriismqkggdlktvykrlvtavdniesklpfshddrfgfltfcptnl
gttmrasvhiqlpklakdrkvlediaskfnlqvrgtrgehteseggvydisnkrrlglte
yqavremqdgilemikmekaaa

SCOPe Domain Coordinates for d1bg0a2:

Click to download the PDB-style file with coordinates for d1bg0a2.
(The format of our PDB-style files is described here.)

Timeline for d1bg0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bg0a1