PDB entry 1bg0

View 1bg0 on RCSB PDB site
Description: transition state structure of arginine kinase
Class: kinase
Keywords: arginine kinase, creatine kinase, phosphagen kinase, transition state analog, adenosine triphosphate, transferase
Deposited on 1998-06-03, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.196
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginine kinase
    Species: Limulus polyphemus [TaxId:6850]
    Gene: AK17
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51541 (0-355)
      • mutation (101)
      • mutation (110)
      • mutation (114)
    Domains in SCOPe 2.07: d1bg0a1, d1bg0a2
  • Heterogens: NO3, MG, ADP, DAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bg0A (A:)
    vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
    dsgvgiyapdaesyrtfgplfdpiiddyhggfkltdkhppkqwgdintlvgldpagqfii
    strvrcgrslqgypfnpcltaeqykemeekvsstlssmedelkgtyypltgmskatqqql
    iddhflfkegdrflqtanacrywptgrgifhndaktflvwvneedhlriismqkggdlkt
    vykrlvtavdniesklpfshddrfgfltfcptnlgttmrasvhiqlpklakdrkvledia
    skfnlqvrgtrgehteseggvydisnkrrlglteyqavremqdgilemikmekaaa