Lineage for d6w1db_ (6w1d B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029490Fold f.71: LYR proteins from mammalian respiratory complex I [418731] (1 superfamily)
    three-helix bundle, with long extended loops that interact with other subunits
  4. 3029491Superfamily f.71.1: LYR protein-like [418775] (2 families) (S)
  5. 3029492Family f.71.1.1: LYR proteins [418863] (4 proteins)
  6. 3029493Protein LYR motif-containing protein 4 [419218] (1 species)
  7. 3029494Species Human (Homo sapiens) [TaxId:9606] [419736] (8 PDB entries)
  8. 3029496Domain d6w1db_: 6w1d B: [412062]
    Other proteins in same PDB: d6w1da1, d6w1da2, d6w1dc_, d6w1dd1, d6w1dd2
    automated match to d5usrb_
    complexed with 1pe, 8q1, dtt, edo, edt, gol, mes, p15, peg, pg4, pge, plp

Details for d6w1db_

PDB Entry: 6w1d (more details), 1.8 Å

PDB Description: structure of human mitochondrial complex nfs1-iscu2 (wt)-isd11 with e.coli acp1 at 1.8 a resolution (niau)2
PDB Compounds: (B:) LYR motif-containing protein 4

SCOPe Domain Sequences for d6w1db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6w1db_ f.71.1.1 (B:) LYR motif-containing protein 4 {Human (Homo sapiens) [TaxId: 9606]}
aassraqvlalyramlreskrfsaynyrtyavrrirdafrenknvkdpveiqtlvnkakr
dlgvirrqvhigqlystdkliien

SCOPe Domain Coordinates for d6w1db_:

Click to download the PDB-style file with coordinates for d6w1db_.
(The format of our PDB-style files is described here.)

Timeline for d6w1db_:

  • d6w1db_ is new in SCOPe 2.08-stable