Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.71: LYR proteins from mammalian respiratory complex I [418731] (1 superfamily) three-helix bundle, with long extended loops that interact with other subunits |
Superfamily f.71.1: LYR protein-like [418775] (2 families) |
Family f.71.1.1: LYR proteins [418863] (4 proteins) |
Protein LYR motif-containing protein 4 [419218] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [419736] (8 PDB entries) |
Domain d6w1db_: 6w1d B: [412062] Other proteins in same PDB: d6w1da1, d6w1da2, d6w1dc_, d6w1dd1, d6w1dd2 automated match to d5usrb_ complexed with 1pe, 8q1, dtt, edo, edt, gol, mes, p15, peg, pg4, pge, plp |
PDB Entry: 6w1d (more details), 1.8 Å
SCOPe Domain Sequences for d6w1db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w1db_ f.71.1.1 (B:) LYR motif-containing protein 4 {Human (Homo sapiens) [TaxId: 9606]} aassraqvlalyramlreskrfsaynyrtyavrrirdafrenknvkdpveiqtlvnkakr dlgvirrqvhigqlystdkliien
Timeline for d6w1db_: