SCOPe 2.08: Domain d6risb_: 6ris B:

Lineage for d6risb_ (6ris B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.0: automated matches [191466] (1 protein)
   not a true family

6. Protein automated matches [190728] (15 species)
   not a true protein

7. Species Azotobacter vinelandii [TaxId:322710] [258948] (19 PDB entries)

8. Domain d6risb_: 6ris B: [411780]
   automated match to d6rj4e_
   complexed with atp, cl, mg, po4

Details for d6risb_

PDB Entry: 6ris, 2.1 Å

PDB Description: the kb42s variant of the molybdenum storage protein

PDB Compounds: (B:) Molybdenum storage protein subunit beta

SCOPe Domain Sequences for d6risb_:

Sequence; same for both SEQRES and ATOM records:

>d6risb_ c.73.1.0 (B:) automated matches {Azotobacter vinelandii [TaxId: 322710]}
nstaeleellmqrsltdpqlqaaaaaaadfrilpdatvisiggqsvidrgraavyplvde
ivaarknhklligtgagtrarhlysiaaglglpagvlaqlgssvadqnaamlgqllakhg
ipvvggaglsavplslaevnavvfsgmppyklwmrpaaegvippyrtdagcfllaeqfgc
kqmifvkdedglytanpktskdatfiprisvdemkakglhdsilefpvldllqsaqhvre
vqvvnglvpgnltralagehvgtiitas

Timeline for d6risb_:

• d6risb_ is new in SCOPe 2.08-stable