SCOP 1.67: Domain d1jaw_2: 1jaw 177-440

Lineage for d1jaw_2 (1jaw 177-440)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Aminopeptidase P, C-terminal domain [55928] (2 species)

7. Species Escherichia coli [TaxId:562] [55929] (5 PDB entries)

8. Domain d1jaw_2: 1jaw 177-440 [41166]
   Other proteins in same PDB: d1jaw_1
   complexed with act, mn

Details for d1jaw_2

PDB Entry: 1jaw, 2.7 Å

PDB Description: aminopeptidase p from e. coli low ph form

SCOP Domain Sequences for d1jaw_2:

Sequence; same for both SEQRES and ATOM records:

>d1jaw_2 d.127.1.1 (177-440) Aminopeptidase P, C-terminal domain {Escherichia coli}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

Timeline for d1jaw_2:

• d1jaw_2 first appeared (with stable ids) in SCOP 1.55
  
• d1jaw_2 appears in SCOP 1.65
  
• d1jaw_2 appears in SCOP 1.69
  
• d1jaw_2 appears in the current release, SCOPe 2.08, called d1jawa2