Lineage for d1a16_2 (1a16 177-440)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) 
Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins) 
Protein Aminopeptidase P, C-terminal domain [55928] (1 species) Species Escherichia coli [TaxId:562] [55929] (3 PDB entries) 
Domain d1a16_2: 1a16 177-440 [41165]
Other proteins in same PDB: d1a16_1
Details for d1a16_2
PDB Entry: 1a16 (more details), 2.3 Å
PDB Description: aminopeptidase p from e. coli with the inhibitor pro-leu
SCOP Domain Sequences for d1a16_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a16_2 d.127.1.1 (177-440) Aminopeptidase P, C-terminal domain {Escherichia coli}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq
SCOP Domain Coordinates for d1a16_2:
Click to download the PDB-style file with coordinates for d1a16_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a16_2:
- d1a16_2 first appeared (with stable ids) in SCOP 1.55
- d1a16_2 appears in SCOP 1.59
- d1a16_2 appears in the current release, SCOPe 2.08, called d1a16a2
View in 3D
