Lineage for d1a16a2 (1a16 A:177-440)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538139Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2538140Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2538141Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 protein domains)
  6. 2538142Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. 2538143Species Escherichia coli [TaxId:562] [55929] (20 PDB entries)
  8. 2538162Domain d1a16a2: 1a16 A:177-440 [41165]
    Other proteins in same PDB: d1a16a1
    complexed with leu, mn, pro

Details for d1a16a2

PDB Entry: 1a16 (more details), 2.3 Å

PDB Description: aminopeptidase p from e. coli with the inhibitor pro-leu
PDB Compounds: (A:) aminopeptidase p

SCOPe Domain Sequences for d1a16a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a16a2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

SCOPe Domain Coordinates for d1a16a2:

Click to download the PDB-style file with coordinates for d1a16a2.
(The format of our PDB-style files is described here.)

Timeline for d1a16a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a16a1