SCOPe 2.05: Domain d1xgnb2: 1xgn B:1-194,B:272-295

Lineage for d1xgnb2 (1xgn B:1-194,B:272-295)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)

6. Protein Methionine aminopeptidase [55924] (6 species)

7. Species Pyrococcus furiosus [TaxId:2261] [55926] (5 PDB entries)
   contains insert domain with a circularly permuted "winged helix" fold

8. Domain d1xgnb2: 1xgn B:1-194,B:272-295 [41156]
   Other proteins in same PDB: d1xgna1, d1xgnb1
   complexed with co

Details for d1xgnb2

PDB Entry: 1xgn, 2.9 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus

PDB Compounds: (B:) Methionine aminopeptidase

SCOPe Domain Sequences for d1xgnb2:

Sequence; same for both SEQRES and ATOM records:

>d1xgnb2 d.127.1.1 (B:1-194,B:272-295) Methionine aminopeptidase {Pyrococcus furiosus [TaxId: 2261]}
mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
gdvfaiepfatigaXrngivaqfehtiivekdsvivtte

Timeline for d1xgnb2:

• d1xgnb2 first appeared (with stable ids) in SCOP 1.55
  
• d1xgnb2 appears in SCOPe 2.04
  
• d1xgnb2 appears in SCOPe 2.06
  
• d1xgnb2 appears in the current release, SCOPe 2.08