Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) |
Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) |
Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins) |
Protein Methionine aminopeptidase [55924] (3 species) |
Species Pyrococcus furiosus [TaxId:186497] [55926] (4 PDB entries) |
Domain d1xgnb2: 1xgn B:1-194,B:272-295 [41156] Other proteins in same PDB: d1xgna1, d1xgnb1 |
PDB Entry: 1xgn (more details), 2.9 Å
SCOP Domain Sequences for d1xgnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xgnb2 d.127.1.1 (B:1-194,B:272-295) Methionine aminopeptidase {Pyrococcus furiosus} mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke gdvfaiepfatigaXrngivaqfehtiivekdsvivtte
Timeline for d1xgnb2: