Lineage for d1c24a_ (1c24 A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) 
Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins) Protein Methionine aminopeptidase [55924] (3 species) 
Species Escherichia coli [TaxId:562] [55925] (9 PDB entries) 
Domain d1c24a_: 1c24 A: [41148]
Details for d1c24a_
PDB Entry: 1c24 (more details), 1.7 Å
PDB Description: e. coli methionine aminopeptidase: methionine phosphinate complex
SCOP Domain Sequences for d1c24a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c24a_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigqgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishd
SCOP Domain Coordinates for d1c24a_:
Click to download the PDB-style file with coordinates for d1c24a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c24a_:
- d1c24a_ first appeared (with stable ids) in SCOP 1.55
- d1c24a_ appears in SCOP 1.59
- d1c24a_ appears in SCOP 1.63
- d1c24a_ appears in the current release, SCOPe 2.08
View in 3D