Lineage for d1c4ka3 (1c4k A:570-730)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2580819Fold d.125: Ornithine decarboxylase C-terminal domain [55903] (1 superfamily)
    complex alpha+beta motif
  4. 2580820Superfamily d.125.1: Ornithine decarboxylase C-terminal domain [55904] (1 family) (S)
    automatically mapped to Pfam PF03711
  5. 2580821Family d.125.1.1: Ornithine decarboxylase C-terminal domain [55905] (1 protein)
  6. 2580822Protein Ornithine decarboxylase C-terminal domain [55906] (1 species)
  7. 2580823Species Lactobacillus sp., strain 30a [TaxId:1591] [55907] (2 PDB entries)
  8. 2580826Domain d1c4ka3: 1c4k A:570-730 [41123]
    Other proteins in same PDB: d1c4ka1, d1c4ka2
    complexed with gtp, plp; mutant

Details for d1c4ka3

PDB Entry: 1c4k (more details), 2.7 Å

PDB Description: ornithine decarboxylase mutant (gly121tyr)
PDB Compounds: (A:) protein (ornithine decarboxylase)

SCOPe Domain Sequences for d1c4ka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4ka3 d.125.1.1 (A:570-730) Ornithine decarboxylase C-terminal domain {Lactobacillus sp., strain 30a [TaxId: 1591]}
aplkqvlpsiyaaneeryngytirelcqelhdfyknnntftyqkrlflreffpeqgmlpy
earqefirnhnklvplnkiegeialegalpyppgvfcvapgekwsetavkyftilqdgin
nfpgfapeiqgvyfkqegdkvvaygevydaevaknddrynn

SCOPe Domain Coordinates for d1c4ka3:

Click to download the PDB-style file with coordinates for d1c4ka3.
(The format of our PDB-style files is described here.)

Timeline for d1c4ka3: