Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins) |
Protein DNA gyrase B [55880] (2 species) |
Species Escherichia coli [TaxId:562] [55881] (3 PDB entries) |
Domain d1ei1b2: 1ei1 B:402-620 [41105] Other proteins in same PDB: d1ei1a1, d1ei1b1 complexed with anp, gol, so4 |
PDB Entry: 1ei1 (more details), 2.3 Å
SCOPe Domain Sequences for d1ei1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ei1b2 d.122.1.2 (B:402-620) DNA gyrase B {Escherichia coli [TaxId: 562]} snssdsssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiiv tihadnsvsvqddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvs vvnalsqklelviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvte feyeilakrlrelsfldsgvsirlrdkrdgkedhfhyeg
Timeline for d1ei1b2: