SCOPe 2.08: Domain d1ei1a2: 1ei1 A:2-220

Lineage for d1ei1a2 (1ei1 A:2-220)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)

6. Protein DNA gyrase B [55880] (2 species)

7. Species Escherichia coli [TaxId:562] [55881] (3 PDB entries)

8. Domain d1ei1a2: 1ei1 A:2-220 [41104]
   Other proteins in same PDB: d1ei1a1, d1ei1b1
   complexed with anp, gol, so4

Details for d1ei1a2

PDB Entry: 1ei1, 2.3 Å

PDB Description: dimerization of e. coli dna gyrase b provides a structural mechanism for activating the atpase catalytic center

PDB Compounds: (A:) DNA gyrase b

SCOPe Domain Sequences for d1ei1a2:

Sequence; same for both SEQRES and ATOM records:

>d1ei1a2 d.122.1.2 (A:2-220) DNA gyrase B {Escherichia coli [TaxId: 562]}
snssdsssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiiv
tihadnsvsvqddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvs
vvnalsqklelviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvte
feyeilakrlrelsfldsgvsirlrdkrdgkedhfhyeg

Timeline for d1ei1a2:

• d1ei1a2 first appeared (with stable ids) in SCOP 1.55
  
• d1ei1a2 appears in SCOPe 2.07