Lineage for d1ieu__ (1ieu -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.120: Cytochrome b5 [55855] (1 superfamily) Superfamily d.120.1: Cytochrome b5 [55856] (1 family) 
Family d.120.1.1: Cytochrome b5 [55857] (4 proteins) Protein Cytochrome b5 [55858] (3 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [55860] (18 PDB entries) 
Domain d1ieu__: 1ieu - [41083]
Details for d1ieu__
PDB Entry: 1ieu (more details)
PDB Description: apocytochrome b5, ph 6.2, 298 k, nmr, 10 structures
SCOP Domain Sequences for d1ieu__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ieu__ d.120.1.1 (-) Cytochrome b5 {Rat (Rattus norvegicus)}
dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
vghstdarelsktyiigelhpddrskiakpsetl
SCOP Domain Coordinates for d1ieu__:
Click to download the PDB-style file with coordinates for d1ieu__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ieu__:
- d1ieu__ first appeared (with stable ids) in SCOP 1.55
- d1ieu__ appears in SCOP 1.59
- d1ieu__ appears in the current release, SCOPe 2.08, called d1ieua_
View in 3D