Lineage for d1blva_ (1blv A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1924455Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 1924456Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 1924457Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. 1924458Protein Cytochrome b5 [55858] (4 species)
  7. 1924478Species Norway rat (Rattus norvegicus) [TaxId:10116] [55860] (20 PDB entries)
  8. 1924501Domain d1blva_: 1blv A: [41079]
    complexed with hem

Details for d1blva_

PDB Entry: 1blv (more details)

PDB Description: solution structure of oxidized rat microsomal cytochrome b5 in the presence of 2 m guanidinium chloride: monitoring the early steps in protein unfolding
PDB Compounds: (A:) protein (cytochrome b5)

SCOPe Domain Sequences for d1blva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blva_ d.120.1.1 (A:) Cytochrome b5 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
vghstdarelsktyiigelhpddrskiakpsetl

SCOPe Domain Coordinates for d1blva_:

Click to download the PDB-style file with coordinates for d1blva_.
(The format of our PDB-style files is described here.)

Timeline for d1blva_: