PDB entry 1blv

View 1blv on RCSB PDB site
Description: solution structure of oxidized rat microsomal cytochrome b5 in the presence of 2 m guanidinium chloride: monitoring the early steps in protein unfolding
Class: electron transport
Keywords: protein unfolding, nmr solution structure, cytochrome b5, electron transport
Deposited on 1998-07-21, released 1998-07-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cytochrome b5)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1blva_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1blvA (A:)
    dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
    vghstdarelsktyiigelhpddrskiakpsetl