Lineage for d1es1a_ (1es1 A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196153Fold d.120: Cytochrome b5 [55855] (1 superfamily)
  4. 196154Superfamily d.120.1: Cytochrome b5 [55856] (1 family) (S)
  5. 196155Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)
  6. 196156Protein Cytochrome b5 [55858] (3 species)
  7. 196157Species Cow (Bos taurus) [TaxId:9913] [55859] (7 PDB entries)
  8. 196160Domain d1es1a_: 1es1 A: [41067]

Details for d1es1a_

PDB Entry: 1es1 (more details), 2.1 Å

PDB Description: crystal structure of val61his mutant of trypsin-solubilized fragment of cytochrome b5

SCOP Domain Sequences for d1es1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1es1a_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus)}
avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfedhg
hstdarelsktfiigelhpddr

SCOP Domain Coordinates for d1es1a_:

Click to download the PDB-style file with coordinates for d1es1a_.
(The format of our PDB-style files is described here.)

Timeline for d1es1a_: