Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.120: Cytochrome b5 [55855] (1 superfamily) small, heme-binding fold |
Superfamily d.120.1: Cytochrome b5 [55856] (1 family) |
Family d.120.1.1: Cytochrome b5 [55857] (4 proteins) |
Protein Cytochrome b5 [55858] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [55859] (13 PDB entries) |
Domain d1ehba_: 1ehb A: [41066] complexed with hem |
PDB Entry: 1ehb (more details), 1.9 Å
SCOP Domain Sequences for d1ehba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehba_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus)} avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfedvg hstdarelsktfiigelhpddr
Timeline for d1ehba_: