PDB entry 1ehb

View 1ehb on RCSB PDB site
Description: crystal structure of recombinant trypsin-solubilized fragment of cytochrome b5
Deposited on 2000-02-20, released 2000-08-09
The last revision prior to the SCOP 1.65 freeze date was dated 2000-11-15, with a file datestamp of 2000-11-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.65: d1ehba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ehbA (A:)
  avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfedvg
  hstdarelsktfiigelhpddr