Lineage for d1lbaa_ (1lba A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579367Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2579368Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2579369Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 2579389Protein Bacteriophage T7 lysozyme (Zn amidase) [55848] (1 species)
  7. 2579390Species Bacteriophage T7 [TaxId:10760] [55849] (2 PDB entries)
  8. 2579391Domain d1lbaa_: 1lba A: [41062]
    complexed with zn

Details for d1lbaa_

PDB Entry: 1lba (more details), 2.2 Å

PDB Description: the structure of bacteriophage t7 lysozyme, a zinc amidase and an inhibitor of t7 rna polymerase
PDB Compounds: (A:) T7 lysozyme

SCOPe Domain Sequences for d1lbaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbaa_ d.118.1.1 (A:) Bacteriophage T7 lysozyme (Zn amidase) {Bacteriophage T7 [TaxId: 10760]}
akqrestdaifvhcsatkpsqnvgvreirqwhkeqgwldvgyhfiikrdgtveagrdema
vgshakgynhnsigvclvggiddkgkfdanftpaqmqslrsllvtllakyegavlrahhe
vapkacpsfdlkrwweknelvtsdrg

SCOPe Domain Coordinates for d1lbaa_:

Click to download the PDB-style file with coordinates for d1lbaa_.
(The format of our PDB-style files is described here.)

Timeline for d1lbaa_: