Lineage for d1b5da_ (1b5d A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2578756Protein dCMP hydroxymethylase [55843] (1 species)
  7. 2578757Species Bacteriophage T4 [TaxId:10665] [55844] (6 PDB entries)
  8. 2578760Domain d1b5da_: 1b5d A: [41058]
    complexed with dcm

Details for d1b5da_

PDB Entry: 1b5d (more details), 2.2 Å

PDB Description: dcmp hydroxymethylase from t4 (intact)
PDB Compounds: (A:) protein (deoxycytidylate hydroxymethylase)

SCOPe Domain Sequences for d1b5da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b5da_ d.117.1.1 (A:) dCMP hydroxymethylase {Bacteriophage T4 [TaxId: 10665]}
misdsmtveeirlhlglalkekdfvvdktgvktieiigasfvadepfifgalndeyiqre
lewykskslfvkdipgetpkiwqqvasskgeinsnygwaiwsednyaqydmclaelgqnp
dsrrgimiytrpsmqfdynkdgmsdfmctntvqylirdkkinavvnmrsndvvfgfrndy
awqkyvldklvsdlnagdstrqykagsiiwnvgslhvysrhfylvdhwwktgethiskkd
yvgkya

SCOPe Domain Coordinates for d1b5da_:

Click to download the PDB-style file with coordinates for d1b5da_.
(The format of our PDB-style files is described here.)

Timeline for d1b5da_: