Lineage for d1jmg__ (1jmg -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Lactobacillus casei [TaxId:1582] [55835] (39 PDB entries) 
Domain d1jmg__: 1jmg - [41008]
Details for d1jmg__
PDB Entry: 1jmg (more details), 2.5 Å
PDB Description: contributions of orientation and hydrogen bonding to catalysis in asn-229 mutants of thymidylate synthase
SCOP Domain Sequences for d1jmg__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jmg__ d.117.1.1 (-) Thymidylate synthase {Lactobacillus casei}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfgiasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapvav
SCOP Domain Coordinates for d1jmg__:
Click to download the PDB-style file with coordinates for d1jmg__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jmg__:
- d1jmg__ first appeared (with stable ids) in SCOP 1.55
- d1jmg__ appears in SCOP 1.59
- d1jmg__ appears in the current release, SCOPe 2.08, called d1jmga_
View in 3D