Lineage for d1jmg__ (1jmg -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35325Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
  4. 35326Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 35327Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 35339Protein Thymidylate synthase [55833] (7 species)
  7. 35421Species Lactobacillus casei [TaxId:1582] [55835] (39 PDB entries)
  8. 35440Domain d1jmg__: 1jmg - [41008]

Details for d1jmg__

PDB Entry: 1jmg (more details), 2.5 Å

PDB Description: contributions of orientation and hydrogen bonding to catalysis in asn-229 mutants of thymidylate synthase

SCOP Domain Sequences for d1jmg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmg__ d.117.1.1 (-) Thymidylate synthase {Lactobacillus casei}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfgiasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapvav

SCOP Domain Coordinates for d1jmg__:

Click to download the PDB-style file with coordinates for d1jmg__.
(The format of our PDB-style files is described here.)

Timeline for d1jmg__: