Lineage for d1bid__ (1bid -)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Escherichia coli [TaxId:562] [55834] (45 PDB entries) 
Domain d1bid__: 1bid - [40960]
Details for d1bid__
PDB Entry: 1bid (more details), 2.2 Å
PDB Description: e. coli thymidylate synthase complexed with dump
SCOP Domain Sequences for d1bid__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bid__ d.117.1.1 (-) Thymidylate synthase {Escherichia coli}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai
SCOP Domain Coordinates for d1bid__:
Click to download the PDB-style file with coordinates for d1bid__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bid__:
- d1bid__ first appeared (with stable ids) in SCOP 1.55
- d1bid__ appears in SCOP 1.57
- d1bid__ appears in SCOP 1.61
- d1bid__ appears in the current release, SCOPe 2.08, called d1bida_
View in 3D