Lineage for d1a3ad_ (1a3a D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971248Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
    beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing
  4. 2971249Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families) (S)
  5. 2971250Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (4 proteins)
    automatically mapped to Pfam PF00359
  6. 2971255Protein Phosphotransferase IIa-mannitol [55808] (1 species)
  7. 2971256Species Escherichia coli [TaxId:562] [55809] (3 PDB entries)
  8. 2971260Domain d1a3ad_: 1a3a D: [40920]

Details for d1a3ad_

PDB Entry: 1a3a (more details), 1.8 Å

PDB Description: crystal structure of iia mannitol from escherichia coli
PDB Compounds: (D:) mannitol-specific eii

SCOPe Domain Sequences for d1a3ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3ad_ d.112.1.1 (D:) Phosphotransferase IIa-mannitol {Escherichia coli [TaxId: 562]}
lfklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylgesiav
phgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltnald
desvierlahttsvdevlellagr

SCOPe Domain Coordinates for d1a3ad_:

Click to download the PDB-style file with coordinates for d1a3ad_.
(The format of our PDB-style files is described here.)

Timeline for d1a3ad_: